SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_611401.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611401.2.81976
Domain Number 1 Region: 15-144
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-33
Family Bromodomain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_611401.2.81976
Sequence length 674
Comment testis-specifically expressed bromodomain containing protein-2 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MASCKPLSVKLKLPNRVQPEFIPHPGMAGRYTNKLHYFKKHLLDEARKKKYALDFLEPVD
TEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIISNCFLFNRSGDVVYR
KGQMLEKFFHKKLRGMPSGPEVPCNRDPKAVGRPRTNAPSSAQTERKCRELLKKLQSITN
QTDAMTRNFFSNKWDSLQKKVDRQYFKSVNEFCLHVDGCFRKYHEPAKILYERVFNQPAA
WCTSMNGNSSLESALNAADLNELLAAAKLTVNSLMQCVQMPGSGEPLTAKSLVETFCDTL
NKMINKMEAGQRNSPNPSSSKRQKMSPEQETDLVQGEFKPAMELLSGNEIDNLMAVSIES
SDDEAIDASMRITDADRCATQKLFAKLPTNAMKEIIHMVQQIEGFSSENCGDLSFDVKGL
ATDTMIMMKSAVTKATRAHSKLKLKDMQPSEKEGLQRALQSQLVNITRMLNKNRRRCGPL
INFRNKNNTANNVVRKRATAPLTAKLKPLQANVMAPQLGAGVVETHNLSDTSDDDVSAPV
KLSAIGGTPMRNLPINSNPLQMQPIRSPPKLPHVVELQMSSSSSSESEMKSKSGRLSRSR
SRSMSDTKLRPRSNSSASSRSNSSSSSGSNAGSSSGSRSRSSSSSSSSSNNSSESNDSSD
VEVVPNVPEGQLRA
Download sequence
Identical sequences Q4V5A7
FBpp0085699 NP_611401.2.81976 FBpp0085699 FBpp0085699 7227.FBpp0085699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]