SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_611536.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611536.1.81976
Domain Number 1 Region: 371-431
Classification Level Classification E-value
Superfamily RING/U-box 0.0000168
Family RING finger domain, C3HC4 0.04
Further Details:      
 
Weak hits

Sequence:  NP_611536.1.81976
Domain Number - Region: 9-66
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0251
Family Rabaptin-5 0.065
Further Details:      
 
Domain Number - Region: 149-205
Classification Level Classification E-value
Superfamily Hypothetical protein MTH393 0.0471
Family Hypothetical protein MTH393 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_611536.1.81976
Sequence length 432
Comment CG3295 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MDSESLACSSVEKDLTRVVSKLEQLHENAEADIGDIATQMSELVEVLSRAEQLVTTLNSS
TQVSQDDPMGDAVSMQVETEPTAPQRLTERQVESVRNALARCHERVQKLSTEHRDLHGSI
SKIGKAIDRNFSADFSSTMRVDVLQDEENLMLLNKAIAKHYCRQGMDDVARTLIRECKMS
PEHAQDVFDSEREFADIYGIWVKIQKRDLTDALKWAKMYSQQLSDRHSLIEFRLHRMRFM
QLVSYGLDSQREAISYARLNFKKFAVRYEHEIANLMASFIYLPSGLENSPYKHFLGQEKW
TELSFIFLKDACQLLGISKNSALSVVVNAGCTALPALLNIKQVMQSRQVLGMWNGCDELP
IEIDLQPEFRFHSIFACPILRQQTSEDNPPKKLTCGHVISNDALHKLSVGHILKCPYCPV
EQNAEEAVRIYF
Download sequence
Identical sequences Q9W2N5
FBpp0071476 FBpp0071476 FBpp0071476 7227.FBpp0071476 NP_611536.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]