SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_611663.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611663.2.81976
Domain Number 1 Region: 669-735
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000539
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 
Domain Number 2 Region: 586-655
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000288
Family SAM (sterile alpha motif) domain 0.038
Further Details:      
 
Weak hits

Sequence:  NP_611663.2.81976
Domain Number - Region: 749-788
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000414
Family SAM (sterile alpha motif) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_611663.2.81976
Sequence length 1023
Comment Liprin-gamma, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MTADNQPLQQQLQHHQHRSPAYPGKPAEAAGGVPQQQQQQQQLPNGIGSSHCNSNSNGIS
STCNSGTAMIHANNSNLIAAGHLAQAAGPAHNAPSSGSALNAVDKRNANLSEPDQDLPPN
LNVNLSPNPSLALGAPHSPTSAASAALLLLESCDGNRNDESRFHHLHSAPRPEATMKLRE
ENDRLNAELLRLRRLLELSTDGAVGGVDTAPEMEAVASGEGSAAKERIERLESELRSVKN
QLLTMRLERKKLRTDKSDLLGQVKQLCASLQEKEQELRDFIRNYQERVRETETTNAKISG
DRDRERFQLLKQARDEAERSLALAQQLSARDLQLQRLQEQLQEARRQLTGCLSDQESLHS
FAPLTPPSAASGMLSQMAAASGMGGGLAGMRGTTEDSGRGNSLSAFSGSLSGGSGATAGD
RNSCSNDSGLRNSSDRESTGGELNFSDGTCDNGPCITVDPDSISLVSSQNMYQFGTPKER
SPTLSPLNSAAYSRSVEQLGSPVDPEGPGNGAISRKFANASKSGPLGARNGRGGTWGSIS
RVFARSRNKNKALSADGVTEYADYSWNPLTEEGYAEKLRLLREASQLPIDRWRATQVLAW
LEVALGMPQYSARCAENVKSGKVLLELNDVELEAGLGLAHPMHRKKLRLAIEEQRRPEMV
RYPLITQLGHTWVATEWLPDIGLPQYAEPFVQSLVDARMLDTLSKKELEKFLGVTRKFHQ
ASIVHGIHVLRIVKYDRQTLAMRRVQSETVDTDPIVWTNQRFIRWVRSIDLGEYADNLKD
SGVHGGLVVLEPSFSGDTMATALGIPPSKNIIRRHLNTEFDALILPARATLGQGIRSGCG
VVPLTGPGGLQHYATTDRRSSGNLRISAWKGSQSSLSKAFRFNSKPHRTGDRSSFGNSTS
PTPSYSSSEGGGGIYATIGHQYPNPHTNLQQQHYHHFLPPPTTAPPPIPSAGGIYSHGPP
PGHRVSAPPVGGALDAVSTDPQMLYEQSRRRVKSISDIGASTSAGSVGACSLGGISASSE
SPE
Download sequence
Identical sequences Q9W263
FBpp0071757 FBpp0071758 FBpp0071757 FBpp0071758 NP_611663.2.81976 NP_995922.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]