SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_611791.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611791.2.81976
Domain Number 1 Region: 122-498
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.8e-145
Family Myotubularin-like phosphatases 0.0000000332
Further Details:      
 
Domain Number 2 Region: 3-113
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-18
Family GRAM domain 0.024
Further Details:      
 
Domain Number 3 Region: 622-685
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000317
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_611791.2.81976
Sequence length 689
Comment CG3530, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MDEIKLAKVENVRMIDRYNTKNPTVGTLYLTATHLIFVEPDSNKETWILHMHVASIEKLP
LSTTGSPLLIRCKTFLSVTFVIPKDSECHDVYTSLLKLFQPVSINKLYCFNYQPNKDDFP
KNAGWDYFKLEAEFKHMLVPNEAWTLCSMNEKYELCDTYPRQIYVPKEATTLMLISSSRF
RSKGRLPVLTYLHNNKASICRCSQPLSGFSARCLEDEQMLEAIRKTNSNTDYMYVVDTRP
RINAMANRAAGKGYENEAFYENIKFHFLGIENIHVQRASLQKVLEACEQKSPTMSAFINA
LESSGWLKHIRSILDTSSFIANAVDKGVSVVVHCSDGWDRTAQVCSLAQLMLNPYYRTIK
GFQALIEKDWLAFGHKFSERCGHIQTDAREVSPIFTQFLDCTWQLMSQRSEAFEFNERFL
LILHDHVHSCQFGTFVGNCEKDRLDLKLAERTFSLWGYMANHLNEYINPLYKPNVDEAIK
ANLAPQCIKFWRGMYSRFESGIHPREPLGDVLLDSKEHCNSLEDHVQHLTKRIASFKNYI
SKSAKKLQDATSAPGKVNKELSSNEINDNKYNYDKKLSELSAADDDHPLKASNMSFASLS
LSAEQSSPPQALPEEINSVAVDWKPMRNVTTCSCSTPFDQFSKKTHCWRCGDIFCERCID
KNVALPGHDSGKPVPVCRGCFRQMQKQSP
Download sequence
Identical sequences Q9W1Q6
FBpp0071937 FBpp0071937 NP_611791.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]