SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_611884.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611884.1.81976
Domain Number 1 Region: 209-286
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000121
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 2 Region: 149-172
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000778
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_611884.1.81976
Sequence length 1231
Comment something that sticks like glue, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSVHYKFKSTLNFDTITFDGLHISVGDLKREIVQQKRLGKIIDFDLQITNAQSKEEYKDD
GFLIPKNTTLIISRIPIAHPTKKGWEPPAAENAFSAAPAKQDNFNMDLSKMQGTEEDKIQ
AMMMQSTVDYDPKTYHRIKGQSQVGEVPASYRCNKCKKSGHWIKNCPFVGGKDQQEVKRN
TGIPRSFRDKPDAAENESADFVLPAVQNQEIPEDLICGICRDIFVDAVMIPCCGSSFCDD
CVRTSLLESEDSECPDCKEKNCSPGSLIPNRFLRNSVNAFKNETGYNKSAAKPAAVKNEE
KPPVEKEVEKKPVAEVEPEETEVKPEKQKESETNGSNPPKSESPEPPATTEPSQKEKDKY
DSDYEDNITIKMPQPAADSTTVPSKRSPSYSHRSESSHRRDRSDYVSDHDHKHQRPSKSE
SVNKDRSLLPLPIGTLPSYQGHMMAESEEARRSSAYKPPYMQMQRGPPPMHMMSHHMPAY
NNGFNNMGQRPPLSYVPYQNQSVHPMRAPYGSAGGGMNMNMSQPFQSPNLASIYQGVAAK
VGSGPIDDPLEAFNRIMKEKERKKVDRFRSSDRHRSRSPDRQRHRFKSPMYEKDNSRDNL
KDKRPRSRERKREHSYERHIRHPRSSRQPNDGSKSPGGRIKRSGHRRSASPKPGYKSDYR
DKPYNKPSAPKTEAVEPPPPGFEPLQLTDEDGYRNKHPTSSEASQSSKGDSSKKRGENRH
EEAPRKRHRSRSISKEPKPNDSNYRSLTPPAKITTPKMTAAQLRQRESSPKTPEKSHDDY
LTAKARIMASQPVINDTEMETNVGKENKAKSPLSKDRKKKKKDKDKAERKKNKKDKRAKK
EKGDRQKKSSSVNRSDSDINNSSLMNESNYKVLSPRAQSPSIEINAAQLSPTHNATENVN
PKSHSILTVGAASDDNLGPRSKLSEANSVNLSKWEIDENILGLEDSSKKAAGASDDPSEI
TSDVLRKAENAIFAKAINAIRPMEFQVIINSKDNSKDRSVVRSDKDRSSSPRRNNSSRSV
KDRLGTKISNDRSRSRDKSKGRRRAARSSDDDANRGRSDRHGSRKRDNRSRDRAAPSEKR
QERSYKRSSPEDDKLRRQNKEQSESKHGKHDQNNSDDSDRRAAKNTKSSDSRVVSSVTAV
VAPPKPCRPDNPFRKFVDTSSSSSLVVKYDNTIQKEGASSDNGMEHRKQRDKKLKKHSKY
SSTDSLKSEKRKDPKSKKKSKILKKKKKSKK
Download sequence
Identical sequences Q9XZ21
7227.FBpp0072158 FBpp0072158 NP_611884.1.81976 FBpp0072158 FBpp0072158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]