SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_611951.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_611951.1.81976
Domain Number 1 Region: 89-379
Classification Level Classification E-value
Superfamily L domain-like 3.27e-36
Family Ngr ectodomain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_611951.1.81976
Sequence length 469
Comment CG4781 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MARLEVIRGLTFALLLTQLLAAHVARAEVIDAEETDRFCYPESSKNSRRSCECSNVSASP
WGNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNIS
QLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLV
LGTLDISWNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAPLKELSLRRNQL
KRIPTQLPETLLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVL
ETLSFQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELD
LNGLPLQCDCELVWLKQLPVQTNGRCYKPARIRGMLVTSARGDAFSCDTWPRWAYGLVVL
SLIALSAAGIYLIVMGLRPHRGVTMRRKVGAGSPYARVTIEPNRQENPH
Download sequence
Identical sequences Q9W128
FBpp0072242 7227.FBpp0072242 FBpp0072242 FBpp0072242 NP_611951.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]