SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_612063.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_612063.2.81976
Domain Number 1 Region: 162-400
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.61e-62
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_612063.2.81976
Sequence length 401
Comment uncharacterized protein Dmel_CG13902, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MDSEFLELTQLLPRWVDLENVVRGEVEARYILKRAADHLANLRSGGDSGAEETGYLVGAL
VDRNWERIHTGHFSQVPLVTRKIYAIACCFKIFFLLLESTSPAQKDACSEILDEAQLLGC
MEDWSELKVALMDYLDKDGAVALNSAPLPTLEPLTRVTSNCDIPQLDAPSLEEFQTKCFE
AGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASDEWSQQLVKIRDFLS
RQFGKEPSKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTPGAVDIKAWLGPAG
TVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYPL
VAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWWE
Download sequence
Identical sequences Q9W0M3
FBpp0289936 FBpp0289936 FBpp0289936 NP_612063.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]