SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_612113.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_612113.2.81976
Domain Number 1 Region: 36-271
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-30
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 2 Region: 401-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 437-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000225
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  NP_612113.2.81976
Domain Number - Region: 371-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000939
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_612113.2.81976
Sequence length 644
Comment cueball [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MIRIRFGMDVLLVLLLATCLLTPAHGTPLEWDFAVTLRTKIQFMDSSWQTIATAAHEFDE
LSALTFDESEELIYFNDLKHRNGSIFSLKRDLIAANHVAEQTIARTGNESVGGLAYDPLN
MNLFWSDTEQRKIFFAPIHGSATPQVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPT
VERINLDGSNRTVIISSNIDMPRGIVVDQLSDRLFWIDDLKGVFFSVESSKLDGSDRQVV
LKDKHHEPLNLAVTNDAIYWTDRTTRAVWSHPKVPVIKVTTTSKPDEEDSTDSTDFKDPE
PVAEDCPLVRVANLSEEARGIVARTGFYQRLQKDHHCASIVRKVKERVDEQSRKFEIRSL
LDQKIKVLEDERCMNDGEYRAATDLCICPTGFKGSRCEIRECHNYCVHGTCQMSELAYPK
CYCQPGFKGERCELSVCSGLCLNGGHCRVSKDENEAPSCECPAKFGGARCEQNSTEICSL
FCRLLKHEPEMYVPFGCHSICEELAQDNSTNIAIPQYQHLEVCLTPRVWTSSVIIILVVG
IVSSLLLVAVIVQGIRRLYKPKRPRIRKTFVVRKQARTNSAGDTPLTNRPLATEQCEITI
ENCCNMNICETPCFDPKLVEQTLSKSSCKEDKKILIHNMEDDLY
Download sequence
Identical sequences Q95RU0
NP_612113.2.81976 FBpp0072590 FBpp0072590 FBpp0072590 7227.FBpp0072590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]