SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_631880.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_631880.2.92730
Domain Number 1 Region: 46-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.33e-34
Family SCAN domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.29e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 524-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 330-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 224-284
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000124
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_631880.2.92730
Sequence length 588
Comment zinc finger protein with KRAB and SCAN domains 8 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MATEPRKPSSAPSPPDQAPEEDLVIVKIEEDHGWDEESGVHENNTPGQELFRLRFRQLCY
QETLGPREALIQLRAFCHQWLRPDLNSKEQILELLVLEQFLTILPGELQALVKEHQLQNG
EEVVTLLEDLERQINVLGRPVSTHTHGHRVLWDEVIPSKSASEPPSIHVQSLATVPKSPV
PQKPQDRGKRPDFTYNAMSSSQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLI
REEWLLDPSQKDLNRDNRPEKYRNMFSLDGETRSENKELFPKQGISPGIQPHGEATAKCN
GDVIVGLAHGETQDLLGKLERHQGNPTQERRHKCDECGKSFAQNSGLVRHWRIHTGEKPY
QCTVCGKAFSYRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQ
CGKAFSQSAGLILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKT
FRRSSHLIGHQRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGN
TGLIQHLRIHTGEKPYQCSECRKAFIQRSSLIRHQRIHSAEKPQSTGV
Download sequence
Identical sequences Q8BSL0
ENSMUSP00000040248 ENSMUSP00000040248 10090.ENSMUSP00000040248 NP_631880.2.92730 ENSMUSP00000040248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]