SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_639403.1.47755 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_639403.1.47755
Domain Number 1 Region: 60-338
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.3e-70
Family alpha-L-arabinanase-like 0.0000275
Further Details:      
 
Domain Number 2 Region: 359-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-21
Family Beta-D-xylosidase C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_639403.1.47755
Sequence length 544
Comment xylosidase [Xanthomonas campestris pv. campestris str. ATCC 33913]; AA=GCF_000007145.1; RF=reference genome; TAX=190485; STAX=339; NAME=Xanthomonas campestris pv. campestris str. ATCC 33913; strain=ATCC 33913; AL=Complete Genome; RT=Major
Sequence
MPTPTRRDVFKLLAASAGAAVAPAALGATAAPPAAACGQLLQWGRGVEGQRTADLGNGTY
RNPIVAGDRPDPTILKDGDDYSMTFSSFFSYPGIVLWHSTDLVNWTPIGPALRQQLGTIW
ALDLCKHDGRYFIYIPANPDDRGWSIFVIWADDIRGPWSAPIDLKIAGCIDPGHVVGEDS
ARYLFVNGIRKIRLRADGLATDGPLEPAYAPWRYPDDWVVENFAPEGPKLNWHNGWLYLV
TAVGGTAGPVTGHMVIAARSRSVHGPWEHCPHNPLVRTQSPQEPWWSRGHATLVEGPRGD
WWMVYHGYENGFRTLGRQTLLEPIEWTADGWFRATGGDLSRPLRTPARTATGSANMATGF
ALSDDFSTDKLGTQWSLHAPKPGEQARIQRGDRVLTLACTGTSPADSAPLTCGVPDRAYA
AEVTLELVGNAEGGILLFYNHKAFVGIGFTADTMKTYEYSEELVWARAPNTQRHIRLRLT
NDQQVVTYHYSFDEGRNWLRHPTRMEVSGMHHNVFGGFLSLQLGIYAAQEGSVVLRDFRY
RALG
Download sequence
Identical sequences A0A0H2XCJ9 Q8P3K7
gi|21233486|ref|NP_639403.1| 190485.XCC4064 314565.XC_4154 gi|66770451|ref|YP_245213.1| NP_639403.1.47755 WP_011039133.1.12496 WP_011039133.1.16446 WP_011039133.1.1732 WP_011039133.1.27778 WP_011039133.1.40219 WP_011039133.1.475 WP_011039133.1.56666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]