SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_647455.3.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_647455.3.92730
Domain Number 1 Region: 486-754
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-76
Family Protein kinases, catalytic subunit 0.000000000129
Further Details:      
 
Domain Number 2 Region: 139-211
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-24
Family Ras-binding domain, RBD 0.00035
Further Details:      
 
Domain Number 3 Region: 211-264
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_647455.3.92730
Sequence length 804
Comment serine/threonine-protein kinase B-raf [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAALSGGGGSSSGGGGGGGGGGGGGDGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAI
PEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESL
VFQTPTDASRNNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCA
VYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLF
QGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPVPQEEASFPETALPSGS
SSAPPSDSTGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPV
NIDEKFPEVELQDQRDLIRDQGFRGDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEIVFDF
EPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSSSEDRSRMKTLGR
RDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVG
VLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQG
MDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPE
VIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRS
NCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDF
SLYACASPKTPIQAGGYGEFAAFK
Download sequence
Identical sequences P28028
ENSMUSP00000002487 ENSMUSP00000002487 NP_647455.3.92730 10090.ENSMUSP00000002487 ENSMUSP00000002487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]