SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_648114.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_648114.1.81976
Domain Number 1 Region: 50-130
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000197
Family Pointed domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_648114.1.81976
Sequence length 600
Comment SMSr [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MCDGEIGDPVTQPRSEGGGLVTMDQETRTHYLDAATDKHLTNGSPDPEPVDPLLVAQWSI
ENVTSWATCMEHFSRTLLDCLRQEAIDGEVLLSLTEEDVRDMRYKLGYKLTFGELKKFWI
AVLKLQLLVKNSSAESVILGIECHGNGNSVYMPLASTGCGPPSSSTCPCPQAECPSYVSD
CDTYLRMGGRYVPPEYFKTAMSLGYSFVVTWITSLTMVIVHERVPDMKRYPPLPDIFLDN
VPHIPWAFNMCEITGSLLFTIWVVVLTFHKYRLVLLRRFFALAGTVFLLRCVTMLITSLS
VPGTHLQCSQKDFAIDDPNVDMVGALIIRMSRAYRIWSGLGMSIQGVRTCGDYMFSGHTV
ALTLLNFFITEYTPRNLYFLHTLTWLLNMFGIFFILAAHEHYSIDVFVAFYITSRLFLYY
HTLANNRALMQSDSKRTRVWFPMFSYFESSVDGMVPNEYDTLGSLIDGIIEQIFKAKDQL
AISVKRCWLDAPLSGNSSAHMFGGESEQCLRNGTASAAFFSPHQSLIGGLGGQRSQTHLN
SAQSGSSTPTPATSAPTKSLPTQKKTFRDASVDPFSRTTFAAVQQAENVKDSPMKEKKHL
Download sequence
Identical sequences Q9VS60
7227.FBpp0076580 NP_648114.1.81976 FBpp0076580 FBpp0076580 FBpp0076580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]