SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_648238.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_648238.1.81976
Domain Number 1 Region: 507-669
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.27e-64
Family A middle domain of Talin 1 0.0000437
Further Details:      
 
Domain Number 2 Region: 2299-2491
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.7e-51
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 3 Region: 678-800
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.75e-51
Family I/LWEQ domain 0.0000798
Further Details:      
 
Domain Number 4 Region: 770-906
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.12e-43
Family I/LWEQ domain 0.00017
Further Details:      
 
Domain Number 5 Region: 1851-1982
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.14e-34
Family VBS domain 0.00041
Further Details:      
 
Domain Number 6 Region: 1235-1371
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.94e-34
Family VBS domain 0.014
Further Details:      
 
Domain Number 7 Region: 203-317
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-29
Family Second domain of FERM 0.00000981
Further Details:      
 
Domain Number 8 Region: 318-408
Classification Level Classification E-value
Superfamily PH domain-like 1.74e-25
Family Third domain of FERM 0.0000575
Further Details:      
 
Domain Number 9 Region: 1093-1218
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000148
Family alpha-catenin/vinculin 0.028
Further Details:      
 
Domain Number 10 Region: 962-1062
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000765
Family I/LWEQ domain 0.0045
Further Details:      
 
Domain Number 11 Region: 2017-2141
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000155
Family VBS domain 0.013
Further Details:      
 
Weak hits

Sequence:  NP_648238.1.81976
Domain Number - Region: 82-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000583
Family Ubiquitin-related 0.056
Further Details:      
 
Domain Number - Region: 1591-1665
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0022
Family alpha-catenin/vinculin 0.064
Further Details:      
 
Domain Number - Region: 1711-1806
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00408
Family alpha-catenin/vinculin 0.039
Further Details:      
 
Domain Number - Region: 1477-1559
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0392
Family I/LWEQ domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_648238.1.81976
Sequence length 2836
Comment rhea, isoform F [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSTLSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQPSEYGLFISDEQNQQ
GVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMN
WVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQ
DKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSE
IDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISW
PLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGI
EGDEGSTMVEESVAPSKATFLQHETNRMEQLNVESLAHPGIMRPYDGERSYMENEVQTVQ
YGAFVGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQE
LGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASHPDEVDTEAISASVSQIAQT
IPEVTKEVRLIAALMENDTSGDQLLEAARNLCSAFSDLLKAAEPESKEPPQHLINAASRV
GEATTHVLSTIAEEEVPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCDDEQARNRV
IGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPK
LKADLLAAARDVSKSLTDMLEHVKLSSREHANRTSTELSPVENVIIGTDILVSTHDPQEM
VRHARTLGQTTAQLIQSIKGEADQQQDADMKRHLLSAAKQLADATAKLVEAARLCSSNPH
DSDNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQH
SQDHQTKETLLQDCKRVADTIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSK
SSRALQPTVTDIPSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHD
VLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGR
DTALALGDFTRSVHGVAATTQNPAIIDCADDVVTSSARLIEQAQRTLQGASNPEALTQAG
REVTGALSATVDCIPGQREVDVALRNVSELSEILSMSEFPPSSRPYATLQSELKQVAEQL
SSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEEEVRSHMIESLRHVST
QSCSLLSTAKSIAADPGQPNAKNLLHAAARGVTESINQLVDASIQSAPGQKECDNAMRNI
EALRLMLDYPHEPINELGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVN
DSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQ
MISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQS
AGGSRERLVDPLLEAVKAVRQYASSSEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEM
VKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTR
ELDSCALAVNAQGLSQRRDNNLHGFSGQTMNSASELIDKLEPIRMAGKNNAEQLGHAVGE
ISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHP
RLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTF
VDYQTRMVARAKEIASLANEMNAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSP
DVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQKEIARSAREVSEKVAQVLAALQAG
SRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTK
VLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASAL
GDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVE
AISQEIRAMHSPPPVGNTQVGPEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRR
AISEMLIVCRSVAWNCAETEELRSRTLEAGTAVGESYRDLLSGILHNCSADDRMHLSRRV
AKCVTDLVAMARLLKGSDWIDPEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVKI
ELDENMKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGKVARRPLTSSDDGQWSEGL
ISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAG
RRLQAAGNAVIKSTDNLVHSAQQGLEAEEEHSLKINTSMVDGMAQEINARSAVLRKEKEL
EEARQLLKNVRHAQRYAKNAQGFTTDESDTEYAYRSQNNTLGRSGYYGSSEMPSSPSYLS
GGQQQKHHYNHASPQPQHFHHPGAVSPPPSNYPPMDDPNGDFPPPPPPLSTTISNMQTAT
SGHSFRPNPKLTANAVPRPYPGSPGGSNGLISAPTTTGTPTNTNYQQSYESSSIKTLNSS
PPAVPKKPTVNRNLAACVQDLHDKTFGQGGVVQLTGGNGYPGQNYEGYTSRYETRNFDKS
ANNTTSSSSELGAVKPLESSFSQMTLNTDGGKISIVDQGSERLTSMTQRVMERKSFTTTT
ESRSETKTEKHSFRLD
Download sequence
Identical sequences Q9VSL8
NP_001246674.1.81976 NP_001261586.1.81976 NP_648238.1.81976 7227.FBpp0076353 FBpp0293740 FBpp0305317 FBpp0305318 FBpp0076353 FBpp0076353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]