SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_648273.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_648273.1.81976
Domain Number - Region: 153-204,433-465
Classification Level Classification E-value
Superfamily TPR-like 0.00294
Family Tetratricopeptide repeat (TPR) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_648273.1.81976
Sequence length 604
Comment signal recognition particle protein 68 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MVVQEDNPNTGDVQEKTETAPVAEPSKIFTVEILHMIKDAQQQHGLRHGDFQRYRGYCSR
RIRRLRKALKYPQGDKRHFKRRDVTIGQLTGKKADERFIHIPLICAERAWAYAMQLKQES
NTEPRKRFHLVNKLRRACFYALQLQELCNTEAFDARTKLECEAYVAWMHGTLHFELQLWK
TAGEHLKRAQVVYENLGKALPEDEQELYRAKVNEFTPNLRYCAYNISGGASGGKIDEILE
LRAQGVLENLDVLVSQTKTESSEGLQTIDWRGRKVTVRPEKVRLFLLSAQELDKSLAKTT
KQDAKIELIERILMDCKDAIQAVRDEIKQDPKLRSLTTGQTVSGVQYLLAYLSYIRHSRT
LQRNLCLVEQAKLNFYDPNLQSQQNVGDGKRVRPQDLARLYEIILQNVTEMQQINGLEDD
ATYQSEVENLAITFKAFRCYYIALTLIDIKKWKEAVALYERASNYATEALKGKSSPEFQL
QEELKKVVSAIDGCKFSAHAYSVLEDDNSEESGTTTKSQKTTKPLYERLSLYKEDQSLHT
KAPNVFKLTPDMEPIPCKPIFFDLAMTYVELPSLEGKLESPGKKGASITGFVKGFLGWGG
GGNK
Download sequence
Identical sequences Q9VSS2
7227.FBpp0076244 NP_648273.1.81976 FBpp0076244 FR544 FBpp0076244 FBpp0076244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]