SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_649214.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_649214.1.81976
Domain Number 1 Region: 248-546
Classification Level Classification E-value
Superfamily L domain-like 1.02e-37
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 747-889
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 8.76e-37
Family Toll/Interleukin receptor TIR domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_649214.1.81976
Sequence length 900
Comment Toll-9, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MCPKYIWDVIVLVCLFLGNVREAYTEFSIQDGLIIEPDSATTSSEEAEEVSKERTDLKSL
MLKYESDDGNSCLLDLIKDEVIWWQFPNGTLRDSTKKYAHKLYLDLSHGNLKDDSDLFRE
AKLSRKVTIWRTEVFSAAFNTLTAAPFRTLYSMRESLKLLSLRGNNFAELIPDAEDFARF
VNESRLEASNSVPHHCELLLLHNTTDLYDRECYLYFNNNTNMGQSITTGRNYTNFIKVLK
DRFDQHGSSSQSIAWATFPKMPRLVELDISNCSIEYVSKEAFRNVSNLRRLFMSDNKIMT
ISHDTFYYVQGVQYLDLSFTNFLTYSYQLQLPTLEMALSLIYGLKIQQNVFKYLPELIYL
DLSHSKMTRNSAVAFAHLGDKLKFLSLCYTAIPMVSSTIFKNTVLEGLDLSGNPYLSYNI
IDDAFDGIANTLKYLYFERSNIKDLEWSKSLKNLQVLGLAGNNINALTPAMFQSLESLEI
LDLSSNHVGNWYRSAFHNNSALRVLNLRSNTINMLSNEMLKDFERLDYLSLGDNDFICDC
HLRAVVEVAAANNKDADCSYRLLNYSQNAVGEEVISLAESLIIDRKLWQSRYIPWLQRSY
SNIREFNRANHIIKLRFSSEDYMVAKCSAAQPYHLGDLDGDLTLKFQLLDYEASQYYCFN
NTDQLQVDELNCQIRSMSDLAEELHHVTNTVIAVMGSLVGACILGFIIYLKRWHIHYYYS
SLKSAALLSSASKESVNKFTNISQRDPSAVYDIFISYCQNDRTWVLNELLPNVEETGDVS
ICLHERDFQIGVTILDNIISCMDRSYSLMLIISSKFLLSHWCQFEMYLAQHRIFEVSKEH
LILVFLEDIPRRKRPKTLQYLMDVKTYIKWPTAKEDRKLFWKRLKRSLEVIGINSREISV
Download sequence
Identical sequences Q9VPH1
FBpp0077898 FBpp0077898 FBpp0077898 FBpp0300871 NP_001246846.1.81976 NP_649214.1.81976 7227.FBpp0077898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]