SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_649255.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_649255.1.81976
Domain Number 1 Region: 364-457
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000203
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_649255.1.81976
Sequence length 484
Comment uncharacterized protein Dmel_CG11396 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSHKISEYFANDPPSFFDELASKPKGNNLSTEGSSSSASSTSSAPNMMSNTFVGFFQPPE
YVETPEAGEDSIKVGDDVRNLWELPRENEPGKLIMPGIHLQTDLADPISVAVTQHLGEAE
LSYRKILRVDDVTQDERGLRTLIHAGCYRTAVNLTGRLLTIYGQGYGRSGQPAKHSPHSL
QLWFTRLALLAKLGEFELLNAEAEPFGQLTSPDVFYDFYPEMYNGKSGSIACFSFRLLLA
ELPIYLGKPHVALDRLSELHVTTREIKEHYLSLHNKAAEEFWQRRCERVLHSIINCGLMM
KKFSMIDDIMEGTLLKRSNLSKEDRRSLYSAWGRIYLQIGDIFGAEQKIAVSRRLREINS
APDLRDLVDKGLIAVAKNDFPEAYVIFQKALHLDTGNTMILNNMGVCLLYAGKLKDAINL
YERAINLNPQKSLNESLLVNLSTLYELESNNSKAKKYNLLRLINRYKPDLNISIEICLKL
QTIN
Download sequence
Identical sequences Q9VPB6
FR740 FBpp0077934 NP_649255.1.81976 FBpp0077934 7227.FBpp0077934 FBpp0077934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]