SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_649719.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_649719.2.81976
Domain Number 1 Region: 815-961
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.57e-31
Family Toll/Interleukin receptor TIR domain 0.00055
Further Details:      
 
Domain Number 2 Region: 122-420,566-633
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000051
Family Ngr ectodomain-like 0.04
Further Details:      
 
Domain Number 3 Region: 688-757
Classification Level Classification E-value
Superfamily L domain-like 0.00000102
Family Ngr ectodomain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_649719.2.81976
Sequence length 965
Comment MstProx [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKLLLTIPDDYCETYCGGICNDTVASKTCDREAYDYIATNEYHLIMRDGHLEVNWKIPDP
NIFIISPISKENRLKLNELIVSDTSYPIRAVDYLRQLGVETVTRFENQINSFKVIERDVH
YINGPKSLKIIIQSNLYLNEIIEYINKTTDNVNEIIINAYKTVENQQIALDNLIFNGKSH
LRSLTFIGFQIENLSTKPFAQFINLKRMVLTNCTVRNLTFLRTLQKSLEHLELDIDNEVD
LKYFTNFSSLKFMKVRNYIPNKNFTALICTHKNCNFIRGINGLECPKLCQCLYIIDDLEL
NIDCSNLGLLQIPPLPIPSYGGVKLNFSNNSLSQLPTMTLPGYKLVKRLDVSRNRLTNLS
INHLPAKLDYLDVSFNEIINMGNDVIKYLRTVPIFKQTGNQWTIHCDDKPLLNFFRHLKL
IIRMKSAEMKPMFLHSLTELPKGFLKFLGKHFIWLGVRKQEYYLINEEQLLQSMHRKLNN
LNTIMSIYKYMEWLHRKLIFVNREYDLFYIRQMAAPCPHKCECCYSRDSLILKIDCRNKF
VYNFPDIVARNSRLMGKQNMSSPMELHLSKNNISNITIAMLPKELRFLDLRFNNLVTLDD
KVLSYLKKNSIKTKLSGNPWNCDCKSRSVLSILRDHEPLEYDVTLKRCNISPTDCPDVCV
CCLDNLTWPSFIVDCRGEGLLQMPSLSSRVTYVDLRNNNLTALSQKNRSSIENRSLKLHL
LDNPWSCSCNDIEKINFMKSVSSSIVDFTEIKCSNGEKLVSINQHIVCPSDLFYYLALAI
SLVATIIALNFLIWFRQPVLVWFYEHGVCLSLSAKRELDKDKRFDAFLAFTHKDEALLEE
FVDRLERGRPRFQLCFYLRDWLAGESIPDCIGQSIKDSRRIIVLMTENFMNSTWGRLEFR
LALHATSRDRCKRLIVVLYPNVKNFDSLDSELRTYMAFNTYLERSHPNFWNKLIYSMPLL
PSYVD
Download sequence
Identical sequences Q9VIA4
NP_649719.2.81976 FBpp0081104 FBpp0081104 FBpp0081104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]