SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_649874.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_649874.1.81976
Domain Number - Region: 138-193
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0847
Family FCH domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_649874.1.81976
Sequence length 195
Comment insulator binding factor 2 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSQAKKAKRPSGLSKDETWKKLGFLPAFKGGKDGEPKKYRALCTHCRKCQSNTSIDRLII
HRKSCLKFREDLTAEFGIKVEATDAAPAEQSSSGSTIDFTSNILLDKLIDEDDSSARNQE
SNLVSYLTDLDQLVIPSSDANRLQKDLIKAETEYLVVKSEYFTKMNEISELKRTVTLLEA
KKTQLEIAKLRAECE
Download sequence
Identical sequences Q9VHG6
FBpp0081464 NP_649874.1.81976 7227.FBpp0081464 FBpp0081464 FBpp0081464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]