SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_650428.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_650428.1.81976
Domain Number 1 Region: 40-209
Classification Level Classification E-value
Superfamily TPR-like 0.00000417
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Weak hits

Sequence:  NP_650428.1.81976
Domain Number - Region: 455-533
Classification Level Classification E-value
Superfamily TPR-like 0.00474
Family BTAD-like 0.088
Further Details:      
 
Domain Number - Region: 296-483
Classification Level Classification E-value
Superfamily TPR-like 0.00921
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_650428.1.81976
Sequence length 632
Comment Mau2 sister chromatid cohesion factor [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSASTSTSTAASQDACYISLLGLAEYFRTSQPPNIKKCIQCLQALFTFMPPSKVEARTHL
QMGQILMAYTKNIDLARQHLEKAWSISEPLPNFDVKFDTASLLAQLHLQTDRNSHQAKAM
LRRAVELSQNNVYWHCKLLLQLAQIHASDREYSLASELLAVGAESADEASATYLKVLFLL
SRAMILMIERKTNDVLALLNSAGQIIDNNIPNPHQKEYLKVFFLVLQVCYYLALGQVKTV
KPSLKQLQMSIQTIMAPNWPSDEAIFGANQLEMFVWLPKEQLYVLVYLVTVSHSMMAGYM
DKAQKYTEKALTQIEKLKQQEDKPILSVFKVILLEHIVMCRMVMGNRELAIREIAAARDV
CMAAPQRSLLRRHSAQLHCLIGLYSMSTNLFEHAERQFVVCVSETSERDLKLFANLNLAI
IYLRTKRDTDLKQILDAVSTENTHTYSSQALMGGFYYVQGLHAFHKNSFHEAKRFLRETL
KMANAEDLNRLTSCSLVLLSHVFLSIGNSKESMNMVTPAMQLASKIPDIHVQLWGSAILK
DLHRMSKDVQHEKDAYANHVKYSENLIADQRKCVQSAHHELVNWFQGDPPVTSGPPAAPV
LLMPESSVTASVPVIASTSTAMQPAGQYGQFY
Download sequence
Identical sequences Q9VFC0
NP_650428.1.81976 7227.FBpp0082507 FBpp0082507 FBpp0082507 FBpp0082507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]