SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_650543.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_650543.1.81976
Domain Number 1 Region: 87-222
Classification Level Classification E-value
Superfamily TPR-like 9.25e-28
Family Tetratricopeptide repeat (TPR) 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_650543.1.81976
Sequence length 263
Comment uncharacterized protein Dmel_CG14894, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAGNANSDDEFHDAIGEEITEKEATSTRQSEKDVDEIVEKQNQLALDDEAEQGAAGGDSI
ATPTTVDSELTIEELREREKDLSPEQLTANKEKADKLKVEGNELFKNDDAEGAAKTYTEA
LDICPSASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQE
DKPDEALEDYKKVTEIDPGQQEAREAQIRLPPIINERNEKLKNEMMSSLKDLGNMILKPF
GLSTQNFQMQQDPNTGSYSINFK
Download sequence
Identical sequences Q9VEV3
FBpp0082765 FBpp0082765 7227.FBpp0082765 FBpp0082765 NP_001262636.1.81976 NP_650543.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]