SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_650740.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_650740.1.81976
Domain Number 1 Region: 84-424
Classification Level Classification E-value
Superfamily L domain-like 6.26e-41
Family Ngr ectodomain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_650740.1.81976
Sequence length 537
Comment CG7702, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKHKLLLLFLAGAALLLATEVRSQHEDIPYQPVSNICQTCLCLSTQDVDHRTHFNLDCSV
RNFEHILARWPEQFGSQAIASGAASEIVVSYSGNRIKLLQQLPATNASLTLSCRHCGLQD
LQAPLFMDVPNVQALYISWNDITDDALVPDLFRGPFRNTRYEPIGLRDLDLSHNRIVRLD
RRLFEHTPHLTKLNLAYNKLSSLDEATTASIGSVATLQRLDLSHNGLMTLPAQLFSKLTS
LRFLDVSGNEFSTMPASLQLLGKSLVQLNLAGNAFLSLKENSLQGLVSLKRLNISSMPSL
RSLEKGALNLPALEHLDCSRNSKLERLELADLLSSRNLSQLDLSWNALTTLVINATGSSN
NSSNSTNETWPRLRRMSISGNPWYCSCELFKALELIGLNHIDREWDGTEARCETPYLLAG
SPLSNLTAERICKMVIPKKYREVDEEPPRFLRRHYIILTAIIASIVLVIGLVIGFVVVCV
RRRLKGSDYGVQPIRYTSVRGSNLSQFSQLQPVSVASKFNNVHAGSSSGVTTGAANA
Download sequence
Identical sequences Q9VE49
FBpp0083079 FBpp0083079 FBpp0083080 7227.FBpp0083079 FBpp0083079 FBpp0083080 NP_650740.1.81976 NP_732365.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]