SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_650898.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_650898.1.81976
Domain Number 1 Region: 20-201
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000847
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 2 Region: 223-254,299-477
Classification Level Classification E-value
Superfamily TPR-like 0.000000143
Family Tetratricopeptide repeat (TPR) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_650898.1.81976
Sequence length 650
Comment signal recognition particle protein 72 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSKDANPKEALIKAAYADVNKFGNNQEFDKAVKAVNRILGVAPDDPTALHCKVVCLVQLS
KFEEAYKFIEKNRLSSLFFEKAYCEYQLNKQQQALKTIDDAGLQPLPPNLKELRTQVLYR
LERYDECLDSYRDIIKNTSDEYEEERRTNLSAVAANLAVDQTKEVPEVPEDTYEQYFNSA
CIQANRQKYAEAERKLRTSEKLCLEDECASEEEIIEEVDVIRVQLAYVLQLQGKTKEASS
IYADCLRHKPKDAALVAVASNNLVVVNKDQNVFDSKKKIRAALADACESRLTSRQKQVIA
LNNCLLALYTNAGDQVQQLSQKLAQTYPQVEFEALLIRCTQLAKDRKHKEAIEQLQKFAA
AHKSHEFVSKFAIIQLQLLQGNRKDAIETLLSLGEAKYKPGVVSALVSLYLGTDNKTAAS
ALLKSAVDWYKKNEVSSGDLSDMWRQAAEFHLRGGASETAASSLEELLKLNPNDTKVLAQ
LVIAYAQFQPKRALELSRKLPKLETLTTASEIDALEAANWVMSAKAAKKTANTKVEPSPS
TPLEKKKNRNRKRKGKLPKNYNAEVAPDPERWLPKYERTGFRKKRGGARGKDVIKGSQGM
ASGAADQYDMSSRVNLTKNSPATPVYQETAPGPRQQHRKGGHKKKKGGRF
Download sequence
Identical sequences Q9VDK7
FBpp0083319 FBpp0083319 7227.FBpp0083319 FBpp0083319 NP_650898.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]