SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_651109.3.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_651109.3.81976
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000799
Family PDZ domain 0.017
Further Details:      
 
Domain Number 2 Region: 112-170
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000606
Family RING finger domain, C3HC4 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_651109.3.81976
Sequence length 567
Comment uncharacterized protein Dmel_CG34375, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MLQLCTIYACANGTLGLNLSRAPWDPYPWVSGVQAKSSAERGGVRLGDTLLELNGADVLG
LKISELANRLQDHWQSGAEVVTLMMWRQQANIDPNEDPAEASHAVHGINQQSLQKFATCL
QHISQLLECPVCLEVIKPPGWQCCNGHVLCNNCRSRSVKCPVCRVPLGPRGRCLLSDKLF
TLLAESFPCDGGKTNKVAASQGHGKLSSVNKCTNEYHNQPKMALAKTSSGKSKCGKQISR
QLETVLVDQSPREIRRKSQQGQEQEQAVQEAVLPRCTLIKVQHQEAAVEHFSEEGHNNML
VKPKLKLSKKSWRITGPDQDGLRCDEVATINNGVQVQEQQQQQERQQLGHEKSASSESEY
QNYHCPTGKSCSSHSYQLGQPVANKLSTVAMQALAVVENSGGASLSAGSHKQAPAAGVNQ
ELPLEAGSIGRREWQLLRHLSGDHRLAVLQIYGTFGERLHVRPQLPLEGVACLRLSEESS
TFGHVRVHTFFLAVIAIGGGDEHAVFLWHLDHLPHGPTFETVIETPGHRFLGPAHSLRCS
WPEIRASGQFLTLRNLAAKCEVTIKSR
Download sequence
Identical sequences Q9VCS5
7227.FBpp0111519 FBpp0111519 NP_651109.3.81976 FBpp0111519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]