SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_651245.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_651245.1.81976
Domain Number 1 Region: 1210-1427
Classification Level Classification E-value
Superfamily TPR-like 4.6e-31
Family HAT/Suf repeat 0.027
Further Details:      
 
Domain Number 2 Region: 522-592
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000455
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 156-263
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000103
Family Cold shock DNA-binding domain-like 0.0068
Further Details:      
 
Domain Number 4 Region: 435-524
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000254
Family Cold shock DNA-binding domain-like 0.031
Further Details:      
 
Weak hits

Sequence:  NP_651245.1.81976
Domain Number - Region: 1165-1233
Classification Level Classification E-value
Superfamily TPR-like 0.00167
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number - Region: 68-182
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0046
Family Cold shock DNA-binding domain-like 0.023
Further Details:      
 
Domain Number - Region: 691-776
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0172
Family Cold shock DNA-binding domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_651245.1.81976
Sequence length 1430
Comment CG5728 [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MVPNEKSFPRGGTIHSEVKTDDVSLNIVFGASQKKVKKAPKVKENLLSYETEEQNGQLEA
FSAETLNMDTLQEDMLVMGVVKELTATALQIALPGRMFARTLVADISDAYTRVAKAAMSG
DTSEYHDLTELFQLGRIVYGKAIKTEKLDTGRVSLLLSLKPADVHGNLHHKSIKKGFIFS
GAVAEALEHGYVIESGVQGLQAFVPCEKPAQKLHVGQLAFLKVKTVHHDTHQSTCTCVQV
EQDQLRIKSQNETNLDYILPGSIVKFKVAKHLKDGLKGSIMNESFSAYVNEHHLANALDT
LDAYELNEDYNARVLYVMPLTKLVYLTLNLDIKTGAAVAKDQDEEEQEVEPIKVGSVVEK
AKVLRLGSGGVVLLLNKKLKGIISYGSIRGNFKGNYDKDEVLSKYGRKTKHKVRILGYDV
IESLYYCSDDPNVVNEKLFCLEDINAGDLVTAKIFKKDDKIKGWSVRIGKVNGILEQFYL
APNVRYDVGQSLKCRVLEVNAERKICYVSNRAEYLGKGIKILTDYASAHVGNVYMGTVVR
CEDTYVLVKFGNGIKGVLHRQNLKENSSFFEGQTTKFRILTRNKDQITLTLPEDKFQLGE
ICPVEITNALDAGLEVKITFAAEDDEEDEDGNPKLEEFVGLIPLRLLSDHLELLHAQMRV
HPAGSYTDAACIMQNIFSLRDVPYFSGQLTKDWQSVQVGDIIRSYVKHATDQVVDLMVCV
RNYNKPVKVHVKMLRLNAVKNAPVELVPEQLLWVKVLSKEVETKTLTVSAKLTDVWSGDL
SDTAKLVEGYLNEVAQIKAGLEEASAPISKYSVGEKINVVFKGIDATTNDWVYTVEGNGK
VSALLLSSLVGTAKAPEMGSKHEAVILWIEYSSDVLLISNKKLDIAHISPSGELSTNLIG
KAGMKAKVLLKLESVAVCSLKKGTNPLVICPIRLHPNDIENSGSAELRQGDFCNIAFIHD
KLHIAVPETVWRLWRGVKRTAGTEVAPVKAKKAKVEESPKQKKTTIEETSAQKKVKAKAK
VETKTEAKAIPTKRKAEVVEKITNGQKKTQPLTNGIVKEKPKQNGKLFFEDKTPAKNAKS
ETPKSNGAEGKSRLPGVSSFWEDDVNQSKEGSSDEDEELNVAETQKNAAKKKRLSAKEKA
KAEIKEEQRLREIEERNADPKARLETIDQYERLVIAQPNNSISWLKYIAFLLSNTEIEKA
RALARRAISTISFRETQELRNMWSALLNMELVYSNNFDDVLKEALNCNDPLEIYISVVDI
LKKNKRKDRLSSVLTTVLNKFKTELRVWPVAAEAYFWLGKSDQVHNLLQRALRALPNQEH
IPCIVSFAKLYAKHDNNDMAQTLLDDVVTSYPKRIDIWSVYVDMLIKAGLIDSARNVLER
AVVQKLKPNKMQVIYKKYLQLEENHGTDATVAKVKQQAEQWVKNYAKTVK
Download sequence
Identical sequences Q9VC94
NP_651245.1.81976 FBpp0084016 FBpp0084016 FBpp0084016 7227.FBpp0084016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]