SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_651894.3.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_651894.3.81976
Domain Number 1 Region: 269-334
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_651894.3.81976
Sequence length 626
Comment septin interacting protein 3, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MQLLLSSVCMALTSAVIGFAYYQKQQFYPAVVYITKSNASMGVIYIQFFVIVFMFGKLLS
KIFLGTLRAAEFEHLLERFWYALTETCLAFTVFRDDFNPRFVALFTVLLFLKSFHWLAEE
RVDFMERSPVLGWLFHIRVGSLLTVLGILDYVLLIHAYNSTLVRGPTVQLVFGFEYAILL
TVIASTAIKYVLHAAEMRTDTPWENKAVFLLYTELVIGLIKVVLYILFVVIMAKIYALPM
FVFRPMFFTIRNFRKALNDVIMSRRAIRNMNTLYPDATPEELRQSDNICIICREDMVNHS
KKLPCGHIFHTTCLRSWFQRQQTCPTCRLNILRTPTVNSTAMPRQGDEAVAAAAGNPIPA
AAGVQPAGGVPPPAPTAVVDGNQARADVNVAGGQALPPNFADLFGDASGLPNGLPNLAGL
QIPPPPVMPMISPFMIPPHFGYLTPLPPPPIPQDLTNFTDEELRAMEGLQRDHIVQRLKL
LQNINLMLDSAGIMMSQYQSLSARLQLTAVTPATAVNGSADSSVYDMPSTSATAMAQLET
HQVTPTAAASSASPTMPAEKVTIEDLGADADEDDIPSTATEAVSIPNSDADFEENSSELG
ELRKRRLKFLEERNKSAATNERTTAE
Download sequence
Identical sequences A0A0B4KHH2 Q95SP2
FBpp0085201 FBpp0303146 FBpp0085201 FBpp0085201 7227.FBpp0085201 NP_001263152.1.81976 NP_651894.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]