SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_653332.3.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_653332.3.92730
Domain Number 1 Region: 186-520
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.41e-55
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000141
Further Details:      
 
Domain Number 2 Region: 525-654
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.19e-30
Family Ricin B-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_653332.3.92730
Sequence length 657
Comment N-acetylgalactosaminyltransferase 7 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MRLKIGFILRSLLVVGSFLGLVVLWSSLSSRPDDQSPLSRMREDRDVNNPLPNRGGNGLA
PGDDRFKPVVPWPHVEGVEVDLESIRRKNKAKNEQERHAGGDSQRDVMQRQYLTFKPQTF
TYRDPVLRPGVLGNFEPKEPEPHGVVGGPGEKAKPLVLGPEYKQAVQASIKEFGFNMVAS
DMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWSTLMRTVHSVIKRTPRKYLA
EIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQARSIGAQKAKLGQVLIYL
DAHCEVAVNWYAPLVAPISKDRTICTVPIIDVISGNTYEIIPQGGGDEDGYARGAWDWSM
LWKRVPLTSREKRLRKTKTEPYRSPAMAGGLFAIEKDFFFELGLYDPGLQIWGGENFEIS
YKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPLYVGSSPTLKNYVRVVEVWWDEYKDYF
YASRPESKALPYGDISELKKFREDHNCKSFKWFMEEIAYDITAHYPLPPRNVEWGEIRGL
ETAYCIDSMGKTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGPDGSKVMITHC
NLNEFKEWQYFKSLHRFTHITSGKCLDRSEVLHQVFISTCDSSKMTQKWEMNNIHSV
Download sequence
Identical sequences Q80VA0
NP_653332.3.92730 ENSMUSP00000034021 ENSMUSP00000034021 ENSMUSP00000034021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]