SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_665714.2.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_665714.2.4139
Domain Number 1 Region: 28-285
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.33e-126
Family MioX-like 0.000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_665714.2.4139
Sequence length 285
Comment inositol oxygenase [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MKVDLGPDPSLVYRPDVDPEMAKSKGSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVMRKR
IQFGSFSYKKMTVMEAVDMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVG
LLHDLGKILALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQ
PHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMVRFHSFYPWHTGGDYRQLCSQQDL
DMLPWVQEFNKFDLYTKCPDLPEVKSLRPYYQGLIDKYCPGILSW
Download sequence
Identical sequences Q9QXN4
NP_665714.2.100692 NP_665714.2.4139 10116.ENSRNOP00000011941 GO.59641 ENSRNOP00000011941 ENSRNOP00000011941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]