SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_680876.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_680876.1.97157
Domain Number 1 Region: 3-83
Classification Level Classification E-value
Superfamily Ribosomal protein S19 2.88e-36
Family Ribosomal protein S19 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_680876.1.97157
Sequence length 92
Comment 30S ribosomal protein S19 [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MGRSLKKGPFVADHLLRKIEALNERNAKEVIKTWSRASTIVPEMIGHTIAVHNGKQHVPV
YITEQMVGHKLGEFAPTRNFRSHVKGDKKARH
Download sequence
Identical sequences Q8DMM7
gi|22297629|ref|NP_680876.1| 197221.tsr0085 NP_680876.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]