SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_680970.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_680970.1.97157
Domain Number 1 Region: 37-264
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.83e-23
Family Tryptophan biosynthesis enzymes 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_680970.1.97157
Sequence length 296
Comment photosystem I biogenesis protein [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MDLRTLFHTATPVIGVVHLLPLPTSARWGGSLKAVIDRAEQEATALASGGVNAIIVENFF
DAPFSKDRVDAAVVSAMTLVVQRLKNLVALPIGLNVLRNDAFSGLAIAACTGAQFIRVNV
LTGVMATDQGLIEGPAHQLLRYRRELGQDIKIFADVMVKHAQPLHSPNLATAVRDTFDRG
LADGVILSGWATGQPPTEEDLSVAARAAKGQPLFIGSGASWDNVAQLVPYVNGVIVASSL
KRNGQIEQPIDPIRVSRFVEAWQRAHHKLQELTRANANCRGSINEPLPAMFVHGQR
Download sequence
Identical sequences Q8DME0
197221.tlr0179 TeR163 gi|22297723|ref|NP_680970.1| NP_680970.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]