SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_681363.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_681363.1.97157
Domain Number - Region: 116-170
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0647
Family NadC N-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_681363.1.97157
Sequence length 596
Comment porin [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MRSNIVKKTYLLASSLGLLGVVAGANIATANEPVKLENLSAAEPQNLQVSEALPAPNTVA
DASSTIRSVNELLANEESMGQVTSVSQLSDVRPTDWAYQALASLVEKYGCIAGYPDGTFR
GNRAATRYEMAAALNACLDVISDRFATKEDLATLQKLMDEFKAELATLRGRVDKLEARTA
ALEATQFSTTTKLTGTAVMSVQFGGRPSSPLPSVRPNDPITGVPLPLAPGRTNPTVIAGV
LLNLNTSFTGTDLLQTTLSTGNGGLDAISTYGLGSQIISTLGTGDAFTAPLPYFSPSQYY
WSNFGPGVTLYRLAYSFKPTKDITITAGPQFYPSDIIDTNSWANSPASDFGSYFFINNPF
IVPYAMNYLGGAGAAIQWNPKEGPFTVRALYIAAGAGTAAAGIAPPNPGGGFAGDPFQAS
LELEYANTFGNGRNSYAVKLQGTYSKTYGIEAQAGGVNFELNLGRLGIFGRAGVAGIPST
YFPGVSPLPFSIGPFPAAGMMAYNFMAGIGYKDLLVPGSVLAVAAGAPFINSAPAVPPIN
NANQVNVEAFYKFPISDNISITPIFTAIINPNNTNGAGAISGQPILQGVIRTTFTF
Download sequence
Identical sequences Q8DLC3
197221.tll0573 gi|22298116|ref|NP_681363.1| NP_681363.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]