SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_681763.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_681763.1.97157
Domain Number 1 Region: 204-438
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.94e-39
Family Pectin methylesterase 0.0064
Further Details:      
 
Domain Number 2 Region: 524-673
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.28e-26
Family Galacturonase 0.035
Further Details:      
 
Domain Number 3 Region: 658-786
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.01e-23
Family Galacturonase 0.057
Further Details:      
 
Domain Number 4 Region: 438-539
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000576
Family Pectin lyase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_681763.1.97157
Sequence length 812
Comment hypothetical protein tlr0973 [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MTSPLSSATLNQLTPLLGSLARLVARGSPLNNQQLQTLLLGVDLQQDPAALAELQRWGQL
LTQLHQNPSEDNRHATVEALMLRGLGEAAVLLAVDTVAGRATETAPPSSQSQRLRASVAR
LDLGMLAPGQRATAEFEVTGGPGQIVVESSQVQVSPQQFGAGTTRIQVVVKPLRSGVVWT
PLRLVTARETLEVPLVVQWSDFQTAPAGLVVAPDGSGDFRTLAEAVRSVSAGTTLYLKAG
THRLEHPLTIDKALTLIGEGMETTRIVCGGEGWVVKFAGEGLFSASDIAFVHEGSHWADV
VEVNRGEISFVHCRFSGGVRDKDNERGGDGLWLGGTVTGLVSNCQATGNQWVGIRVCEQA
QPTLEGNTCQGNNLCGIAYFGNAGGIARQNTCSGNEQRGILVGEQAQPTLEGNTCQGNKG
SGIAYGGRAGGVARQNTCSGNEDHGIYVDKQAQPTLEGNTCQGNKLNGIAYFGSAGGIAR
QNTCSGNEYYGIYVGEQAQPTLEGNTCQGNKLCGIAYVGSAAGIARQNTCSDNGCGIVVG
EQAQPTLEGNTCQGNKQCGIAYVDSAGGIARQNTCSGNEYHGIELGQQAQPTLEVNTCKG
NKQSGIAYFGSAGGIARQNTCSDNEYRGIELGEQARPTLEGNTCQGNKRSGILYAGSAGG
IARQNTCSGNEYQGIYVGQQAQPTLEGNTCQGNKGSGIAYGGRAGGVARQNTCSGNEDHG
IYVDKQAQPTLEGNTCQGNKQVGIGYFGSAGGIARQNTCSGNGDAGIYVGWQARPTLEDN
TCQGNRGGTVNDMRLLFKNPLTYLMTLLNGNT
Download sequence
Identical sequences Q8DK93
197221.tlr0973 gi|22298516|ref|NP_681763.1| NP_681763.1.97157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]