SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_681976.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_681976.1.97157
Domain Number 1 Region: 26-391
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.48e-77
Family Pyruvate oxidase and decarboxylase PP module 0.069
Further Details:      
 
Domain Number 2 Region: 398-610
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.06e-24
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_681976.1.97157
Sequence length 812
Comment phosphoketolase [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MVSSPPRPTALTDDIHAFGPARATIQGQPLSDSEVEAMDAFFRACNYLAVGMIYLLDNPL
LKEPLKPEHIKKRLLGHWGSSPGLAFCYLHLNRIIKKYQQEVIFLAGPGHGAPGVLAPVY
LEGSYSEIYPNISEDAAGLKKFFKQFSFPGGIGSHCTPETPGSIHEGGELGYVLSHACGA
AFDNPDLIVAAVVGDGEAETAPLATSWHINKFLNPARDGAVLPILNLNGYKINNPTILAR
IPHQDLENYFRGLGYDPCFVEGSDRPSMHQAMAATLDYCVTRIKEIQRTAREEGLTTLPR
WPMIVLRTPKGWTGPAEVNGHKVEGSWRAHQVPLADVHTNPENLQLLENWLRSYRPEELF
DHNGTFRPDLKALAPTGNYRMGMNPHANGGLLRKDLKMPNFREYGITFDKPGQIEVENTR
PLGVFLRDVMRNNPRNFRIFGPDETTSNKLNAVYEASKKFWIAESFDEDADGGELSPEGR
VIEMLSEHTLEGMLEGYLLTGRHGFFSTYEAFVHVIDSMFNQHAKWLSICNELSWRADVS
SLNLLITSTVWRQDHNGFTHQDPGFLDIVCNKSAKVTRIYLPPDVNSLLSVADHCLRSKN
YVNVIVSDKQLHLQYLTMDQAIIHCTKGVGIWDWASNDQGYEPDLVMASAGDIPTQEALA
AIALLRQEFPELKIRYINVVDLFKLQPETEHPHGLSDRDFDSLFTLDRPIIFNFHGYPWL
IHRLAYRRHNHRNLHVRGYKEKGNINTPLELAINNEIDRFSLAIDAIDRLPELQVAGAHA
KEKFRNMQIAARNYAYEYGVDKPEFSHWTWPF
Download sequence
Identical sequences Q8DJN6
NP_681976.1.97157 197221.tll1186 gi|22298729|ref|NP_681976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]