SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_682843.1.97157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_682843.1.97157
Domain Number 1 Region: 9-230,326-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.4e-34
Family FAD-linked reductases, N-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 230-312
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000916
Family D-aminoacid oxidase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_682843.1.97157
Sequence length 372
Comment hypothetical protein tll2053 [Thermosynechococcus elongatus BP-1]; AA=GCF_000011345.1; RF=reference genome; TAX=197221; STAX=146786; NAME=Thermosynechococcus elongatus BP-1; AL=Complete Genome; RT=Major
Sequence
MTVLPANATVTIVGAGVVGSAIAYELSRVLDAAATPILVLEAQREEDWQATGAALGVLIV
HLSRRRRGRNFQLRQASLARYETLIPELEAQTGIKIPYQRQGIVEICTTEAAAIAAQAWL
QEQTPSGVRWLSPAEVQDHCPLLELHHIHGALWATGDRQVTPKPLTQALRQAARQRGVQF
FYQTPVRQLQRSRGWILELDQTSLETEYLILAAGLGTTPLTEALDRPVTLEPVLGQALEF
ACQVDGNTPVMTADGIHFVPLPWGRVWVGATVEFNALIGNPQTLDQLRRRASELWRVLET
APLTQQWQGVRPRPSDRPAPIIERMDDHTWLATGHYRNGILLAPVTAQKIAASVITALAE
GDRPKGHTALIK
Download sequence
Identical sequences Q8DHA6
gi|22299596|ref|NP_682843.1| NP_682843.1.97157 197221.tll2053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]