SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_683735.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_683735.1.92730
Domain Number 1 Region: 104-193,232-488
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.93e-30
Family Glycerol-3-phosphate transporter 0.048
Further Details:      
 
Domain Number 2 Region: 494-539
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000025
Family Ovomucoid domain III-like 0.013
Further Details:      
 
Domain Number 3 Region: 577-689
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000471
Family Glycerol-3-phosphate transporter 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_683735.1.92730
Sequence length 723
Comment solute carrier organic anion transporter family member 4A1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MPQHAMGDTHFLSLPKHLFTSTSSATDSGCDTPPSSRASPASLRSAHGTLGSSSQPLFEP
QAEKRSSQTAREVQYVSSGPQNSLCGWQAFTPKCLQVFNTPKGFLFFLCAASFLQGMTVN
GFINTVITSIERRFDLHSYQSGLIASSYDIAACLCLTFVSYFGGNGHKPRWLGWGVLVLG
IGSLVFALPHFTAGRYEVEMDEGLGTGTCLTNQSHVECKDSASGLSNYRLIFMLGQLLHG
VGATPLYTLGVTYLDENVKSSYSPIYIAIFYTAAILGPAAGYLIGGAMLNVYTEVGQRTE
LTTDSPLWVGAWWIGFLGTGIAAFLIAIPILGYPRQLPGSQRYVVMRAAETQQLKDHSRG
AVSNPAFGKTVRDLPLSIWLLLRNPTFILLCLAGATEATLIAGMSTFGPKFFEAQFSLSA
SEAATLFGYLVVPAGGGGTLLGGFLVNKFKLRGSGIIRFCLFCTLTSLLAFFVFLMHCPN
VHMAGVTTGYVGSLLPKGQLDLKAACNAIYCCQPKHYSPLCGSDGTMYYSPCYAGCPADA
ETDLGGQKVYRGCSCILEKASSGWGNATAGKCASTCQSKPFLLVLVFVVIIFTFLSSIPA
LTATLRCVSDRQRSFALGIQWIVVRTLGSIPGPIAFGWVIDKACLLWQDQCGHQGSCFVY
ENEAMSRYMLIAGLTFKVLGFLFFVAAYFLYKSPSVSSDGLEASLPSQSSASDSPTEQLQ
SNV
Download sequence
Identical sequences Q8K078
ENSMUSP00000045023 10090.ENSMUSP00000046502 ENSMUSP00000045023 NP_683735.1.92730 XP_006500610.1.92730 ENSMUSP00000045023 ENSMUSP00000046502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]