SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_689673.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_689673.2.87134
Domain Number - Region: 88-124,201-234
Classification Level Classification E-value
Superfamily RNI-like 0.00235
Family Cyclin A/CDK2-associated p19, Skp2 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_689673.2.87134
Sequence length 243
Comment uncharacterized protein C17orf77 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MDELALSFSLTCLLPENRASLSPSQPLSFQCLKAPATLTWEDEKQQRWGQPHGPVSSPLL
GDHRCLVPFRDLNPSSEVNTANLLESPSSLLLTSCYICSYFSFYILGEKRCHSLKRLRYS
VCCKVCPNFCACGKENVSGTGQVCTGVHVGAKEQEEPGGTQALRSCGIYCLEERTDKASH
EECRERSTLGRPQCTGLTPSLAGESPCPRLLPGSPTVRHLIASSCPGLSDPLPLPPGTLP
LGS
Download sequence
Identical sequences Q96MU5
ENSP00000329353 NP_001289738.1.87134 NP_001289738.1.92137 NP_689673.2.87134 NP_689673.2.92137 ENSP00000329353 ENSP00000376396 9606.ENSP00000329353 gi|48255962|ref|NP_689673.2| ENSP00000329353 ENSP00000376396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]