SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_689818.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_689818.2.92137
Domain Number 1 Region: 69-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 17-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Weak hits

Sequence:  NP_689818.2.92137
Domain Number - Region: 146-289
Classification Level Classification E-value
Superfamily RNI-like 0.00785
Family 28-residue LRR 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_689818.2.92137
Sequence length 327
Comment zinc finger protein 781 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MQRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQHNRIHTGGKP
YECKECGKVFICCSTLIQHKRTHTSEKPYECLECRKTFRRSAHLIRHQRIHTGEKPYKCK
QCWKAFASVSDLIDIGKFTLMRDFTNVQNVGRHLTIAQLLFSIREFTLVRSPLNVRNVAK
HSIIAQHLLNTRELILMRNLMNVRNVKRLLGKVHILLNIKEFILVRNHMSVSNVGRLSLV
FLILIDIREFTLVKNPMNVKNVVELLTIVQLLFNTREFTLVRRLMNISSVGRFLSPVQHL
FNIREHILMKNLMNVSNARRPSSIMHI
Download sequence
Identical sequences A0A024R0G3
ENSP00000351391 ENSP00000466370 ENSP00000351391 NP_689818.2.87134 NP_689818.2.92137 gi|46094068|ref|NP_689818.2| 9606.ENSP00000351391 ENSP00000351391 ENSP00000466370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]