SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_694712.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_694712.1.92730
Domain Number - Region: 16-110
Classification Level Classification E-value
Superfamily DNA clamp 0.0118
Family DNA polymerase processivity factor 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_694712.1.92730
Sequence length 276
Comment checkpoint protein HUS1B [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MRFRARITSKRFIELFIQVSSTVAKLAKVCVLRVCPDRLYFCPMGLLGEAQLWGEMRRDV
FHHFCMEGASQEFNEICLELMSEHLARAVKNAGNASSLKLQLTNKQRPCLTLVVELASCP
GHTRAVVHDLPVRVLPRRRWKDCTEPHVRGSDVSVYLPALKTLKNMVERMANVGSHVLVE
ANLNGRMNLTVETDRVTIKSYFKNLGNPPNAVLCMSQGRDPETMVQVRVDNRKLLQCFDG
HQINPTMALCNILSNTLLHLVLVHEDISLQYFIPAS
Download sequence
Identical sequences Q059L7 Q8K572
10090.ENSMUSP00000100007 ENSMUSP00000100007 ENSMUSP00000100007 ENSMUSP00000100007 NP_694712.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]