SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_694962.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_694962.1.87134
Domain Number 1 Region: 89-400
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000294
Family 28-residue LRR 0.042
Further Details:      
 
Domain Number 2 Region: 8-67
Classification Level Classification E-value
Superfamily F-box domain 0.000000000419
Family F-box domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_694962.1.87134
Sequence length 442
Comment F-box only protein 39 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MDEESELIQPQDQSCWAFLPDLCLCRVFWWLGDRDRSRAALVCRKWNQMMYSAELWRYRT
ITFSGRPSRVHASEVESAVWYVKKFGRYLEHLEVKFMNPYNAVLTKKFQVTMRGLLSCLS
KSNNRLKSLSIQYLELDRLVWRNSIRSSFISSLSFFLKKMGKRLDYLNLKGARLTVEQGC
QILDSLSYMRNENVISELNIEDYFSHHLAVYNSPQFKKTMSTFHNLVSLNLNYNCISDEL
LENLCENASTLRTINIKCHVHDPHGQVIWGMSWAKLARQATNLKVNFFFERIMKYERLAR
ILLQEIPIRSISLRSCYFSDPDCSMRPTLIDLLPTFRHTLQKLTCEFNNNHESLDEELHL
LIISCRKLFYFKIWAFLDVSFVERILKSQKERQCALRVFKARIYTNRYETNEEDKTLQEI
YRKYRKLIESELSYFVIVYSVM
Download sequence
Identical sequences Q8N4B4
NYSGRC-23397500 9606.ENSP00000321386 NP_694962.1.87134 NP_694962.1.92137 XP_011521999.1.92137 ENSP00000321386 ENSP00000321386 ENSP00000321386 gi|23397500|ref|NP_694962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]