SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_694966.3.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_694966.3.87134
Domain Number - Region: 20-102
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00147
Family Double-stranded RNA-binding domain (dsRBD) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_694966.3.87134
Sequence length 282
Comment protein limb expression 1 homolog [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MDRTLESLRHIIAQVLPHRDPALVFKDLNVVSMLQEFWESKQQQKAAFPSEGVVVYESLP
APGPPFVSYVTLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES
VQEAVASTSGTLDDADDPSTSVGAYHYMLESNMGKTMLEFQELMTIFQLLHWNGSLKALR
ETKCSRQEVISYYSQYSLDEKMRSHMALDWIMKERDSPGIVSQELRMALRQLEEARKAGQ
ELRFYKEKKEILSLALTQICSDPDTSSPSDDQLSLTALCGYH
Download sequence
Identical sequences Q8N485
gi|167466286|ref|NP_694966.3| 9606.ENSP00000274382 ENSP00000274382 ENSP00000274382 NP_694966.3.87134 NP_694966.3.92137 ENSP00000274382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]