SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_695017.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_695017.1.87134
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8e-25
Family Bee venom hyaluronidase 0.0021
Further Details:      
 
Weak hits

Sequence:  NP_695017.1.87134
Domain Number - Region: 154-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0204
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_695017.1.87134
Sequence length 176
Comment hyaluronidase-1 isoform 5 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVV
LWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKAL
LLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
Download sequence
Identical sequences NP_695017.1.87134 NP_695017.1.92137 ENSP00000390149 ENSP00000461900 gi|24497572|ref|NP_695017.1| ENSP00000390149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]