SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_719926.2.27637 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_719926.2.27637
Domain Number 1 Region: 34-106
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.000023
Family Coronavirus S2 glycoprotein 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_719926.2.27637
Sequence length 217
Comment lipopotein of unknown function DUF2959 [Shewanella oneidensis MR-1]; AA=GCF_000146165.2; RF=reference genome; TAX=211586; STAX=70863; NAME=Shewanella oneidensis MR-1; strain=MR-1; AL=Complete Genome; RT=Major
Sequence
MKRLITSSLIAATLLLTGCQTAYYGAMEKVGYHKRDIMVDRVKAAKESQEDAQKEFSSAL
EEMQALLNHNGGNLEKAYNKAKDEYESAQSAADDVSNRINKVEDVAEALFDEWQTEIAEI
SKASLRRNSETKLKETRRSYEQLIKTMRRAESKMPPILTAMKDNMLYLKHNLNAQAIGAI
KGEFASLQTDISGLIKEMNKSINESTRFIEALENAKG
Download sequence
Identical sequences Q8E983
NP_719926.2.27637 gi|414562276|ref|NP_719926.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]