SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_722725.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_722725.1.81976
Domain Number 1 Region: 150-226
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.69e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00071
Further Details:      
 
Domain Number 2 Region: 62-154
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3e-19
Family Cold shock DNA-binding domain-like 0.00027
Further Details:      
 
Domain Number 3 Region: 5-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 8.79e-18
Family ECR1 N-terminal domain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_722725.1.81976
Sequence length 232
Comment ribosomal RNA processing 40, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSATSTIVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNY
QRRYIPARGDLILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDLIPGDLIYA
RVLNASADIEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRENCPVLAALTRELP
YEIAVGVNGRIWLKAHSLKETVALANAISALEQSGCAEIDKICGNLGDFLQA
Download sequence
Identical sequences Q8IPX7
FBpp0077551 FBpp0077551 NP_001285565.1.81976 NP_722725.1.81976 FBpp0077551 7227.FBpp0077551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]