SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_722907.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_722907.1.81976
Domain Number 1 Region: 20-96
Classification Level Classification E-value
Superfamily RING/U-box 0.0000165
Family RING finger domain, C3HC4 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_722907.1.81976
Sequence length 773
Comment male-specific lethal 2, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAQTAYLKVTRIAMRSASNLSKRRVEELNSGLGELRQLLSCVVCCQLLVDPYSPKGKRCQ
HNVCRLCLRGKKHLFPSCTQCEGCSDFKTYEENRMMAAQLLCYKTLCVHLLHSALFGELA
GMRPQVARELVPRIKLPPKTTQEFIREGSNISDTFDIFLPQPDLPFLKDMPTSLPAETPP
TSAVTTPELPYDHHLNISDIEAEAAATAEQGHFSPLPLLPTGSRMGMLSHAGQIVIATES
SESGFMDQAWTDQVDLSGTVSVSKYTNSGNNFAVSYVMPTSATTKFDPQELQIGQVVQMA
DSTQLAVLAAVEETVETSTQLTVLSTTVEETVETSTQLEVLTSAEEPNEISDQLANLQVE
ESDEALVEETVEEAEGTSIPSEVVAEHMEEDQHLDVHTSQSPTQTEMEEAVEEHVATKTQ
LGHVQTELQDAESLQKDFEDAKAAAEEAKEKEKDLHAISAELQKEDSDEPTLKRKRTRTL
KASQAAKIEPVPSEVKTKVQSGKGALRRIRGKDKEEKVKPPKPKCRCGISGSSNTLTTCR
NSRCPCYKSYNSCAGCHCVCCKNPHKEDYVESDEDDDLEDFEMPKDVPEPMTQSEEPVVA
EPRQEENSMAPPDSSAPISLVPLNNLQQSQHPLVLVQNEKGEYQGFNIFQGSKPLDPVTV
GFTIRVQLQHTDGFGSLPQYAYIMPTIDPPNPPAPSLSPPPPPAPDREVIEPPAKKFRTS
RTRRGRANFSALDTVDELVSGGSRSNSAAGDRSSATDNAHSLFEEIMSGSDDL
Download sequence
Identical sequences A4V038 P50534
FBpp0077259 FBpp0077260 FBpp0077259 FBpp0077259 FBpp0077260 7227.FBpp0077259 NP_523467.1.81976 NP_722907.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]