SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_724046.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_724046.1.81976
Domain Number 1 Region: 55-281
Classification Level Classification E-value
Superfamily L domain-like 8.5e-36
Family Leucine rich effector protein YopM 0.05
Further Details:      
 
Domain Number 2 Region: 662-775
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-26
Family Calponin-homology domain, CH-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_724046.1.81976
Sequence length 809
Comment Leucine-rich-repeats and calponin homology domain protein, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MAATVYQRLHSVAVGVGSAAGSAIGSGSASLPGSGTGSGSGIGHAGNTSSSTSSALLSHS
QLTRSLERILEEAHFSGELILTNRKLKDFPRTGTKYSLTDTVIADLSRNRFAELPEEVTT
FAFLETLLLYHNTIRSIPESVKQLSSLTYLDLRSNQLSSLPREICFLPLQVLLVSNNRLT
SLPDELGRLDQTLTDLDASYNQLANLPARLGELRSLRSLSLRSNHLLYLPRELTCLSLIS
LDVSNNKIASLPLEIRHMSTLVELQLENNPLTSPPASLCMRGLVHVFKFLETQATKDEKG
SRSGGNYDGYTTLRRAPRHNSSGNVLEASTTGSTNNQRRHQVDSGYNTSDGLDKRWSHDA
PTKSKTDSPLHCVSNSTAATLPRTLPSAVHSQADLMDASLTSSTSTIVDESLTLSPTASP
CKLSYAHSNSSSNGSSPDQDDDIMLDHQERTVHHANGRSGKGLGNIQTYKEYKEALKQQR
NQEISVYKQKHPNANHSPNDDEDLSPSPPSISNGSSSNTLPKSIMKQNSNQIGHNGNGNG
SANGNGVDDVVIPKKPIQKVIPSRITEIKPASTSDIRSANSSDCLGYVKPQSPMKNGTSK
FNTSNGGGVQTTVGIVSSTTIKSPVSSTTKLGTVKTHRSVTWNHDIPAEKLSFTMRREFD
RQREETELMSQLRTIIETRLKMTLPVDIASALTDGVILCHLANYVRPRSVASIHVPSPGV
NKLTMARCRRNVDNFLEACRRIGVDENLICCAADVLEGKGAVQVAITVGELFRLHGNGGC
GSGNSSGAATPTKSPTRTTRATMSPTPLA
Download sequence
Identical sequences Q960C5
FBpp0080521 FBpp0080521 NP_724046.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]