SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_724201.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_724201.1.81976
Domain Number 1 Region: 565-655
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000095
Family Canonical RBD 0.0094
Further Details:      
 
Domain Number 2 Region: 922-992
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000604
Family Canonical RBD 0.015
Further Details:      
 
Weak hits

Sequence:  NP_724201.1.81976
Domain Number - Region: 360-389
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 7-76
Classification Level Classification E-value
Superfamily PWI domain 0.00562
Family PWI domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_724201.1.81976
Sequence length 1062
Comment second mitotic wave missing, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEE
TTRFVERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVAD
SPPPPPKDNVIKPDSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDHKTKD
SHNQQSASNYQHHHVRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRAS
LRSRSRSRSRSNERAFRRSRSRDRRVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRR
IGGNADDRPRFGNNKSRRSHSRSMSPERNARRNQNSPDRVQTAQANLIPAPVAPPAPVEH
PASHPRQRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDAPEIWAR
SGGPPPGAGQGPVPPPTQPGQTTINPFSGNVRPTTLMSGSGPSPMGVPNPADYARNPGAP
PQAAMMPFPFNPTAVTTPLQRQLIPIPVVDGAPTGGVAEVGKRRFELEDTVAIADVPTKR
KVPINSRLGPRVNPNMQQHNSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDPE
AAIVTFSTHAEANVAYRSTEAVLNNRFIKVFWHNDSSGADVGQMNQMGGGGGGGGRKNAS
QYHLHNVPAVPTPNADGAKISNANPLTEAGAGNIGTPATEQANTAAPASMRLKLNTTTAG
GSAGGAAGAGAPGSGRPLNPAANAASIRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQM
KTALELVERMDQQDPQRAPTLQTIKVLQMTIDKLRKEIKADQDQLQAQMQQQQQQQQPPV
KKTKEQQKKELLDMELELIAQQQEGNDTTAIQKRLEELQRNLGVGSAANNKSTHYAPASG
APGGGAGRKRPNLPEGPTRVDRRPKAIVVTGFAAEEADFVLGHFKNFGEISKHDVDREIP
QLILSYATRLNAEQAVLRGKMYKDKRLQISWAPVVTPAPAPMAAPVEKSAAPGDMSVSLE
NPKQLIQSVSESESLLGSDTLPELRLEDEEEDEESEDRSWRR
Download sequence
Identical sequences Q9VIV2
FBpp0080785 FBpp0080786 NP_609976.1.81976 NP_724201.1.81976 FBpp0080785 7227.FBpp0080786 FBpp0080785 FBpp0080786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]