SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_724371.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_724371.2.81976
Domain Number 1 Region: 378-402
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000968
Family CCCH zinc finger 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_724371.2.81976
Sequence length 726
Comment uncharacterized protein Dmel_CG31601, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSHSDGNEEKVTSLTKRNPGNLYFNLENTQLEGDDEKAFRYTKRNGHHSMAAAASSVSLG
ITEPTEASQDITNYWMEYCAANENARSLCSGDVTSSSLSKNLSVRKAVPQSSSPQSNFVY
KPFDYTLHGLTDFESTMSSARMSSSQSSELFRKENYRFENSATGLDDDSNDILSSTMKDP
QDILSFFSDECEIDNLDSLKKNKNPQNRPAKFTITAYKDIGKDNLSDFEVTNLIDGSHKN
IYIGATQYKLKAQQNQVQPVDKGFCVKVSKEGSDQQQKNNILEPGELSEDDTSESQKVRC
DYKTSDMEDGEVSCEDFDAPPNLIKKKSLCQFDNTSFEKKNVSVDKKHDPVESVDLEDGE
LFGEDNEVSSNTIKKEDNRMPICRYHIRNCCIWGQNCRFRHPNLNRLGKYVMFEKKCLPV
PTVTFPPVWSTCVLPAKDTYPMEVIEKMSRMPKSLEISFGMNNMDNDPYYTQNEPEVNKR
APLLPTPTISELLAEQKQYHNSLAGNRPVRTSRYSRNLRSTQANGTSFLTCLEKRDRSPR
LPRYSARKNQQPQISLGNIRRPSGIIVRPKPKRQRLSDSTFSSTDSSESSSYESTTESTD
DISSFSESDGRGQKNSSSLLGILIKNMKRNEEKFSSDADARFTTKRPNYSKFRNQKQTLS
KLSTKTPVRNPPNVLPNAPKKPHSVLESSNSIKKKQDRQKYLLMQLLRVEQQIEKKKKHR
MKAFKE
Download sequence
Identical sequences Q8IMF0
FBpp0300162 FBpp0300162 FBpp0300802 NP_001246130.1.81976 NP_724371.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]