SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_724753.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_724753.1.81976
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000000385
Family SAP domain 0.0028
Further Details:      
 
Weak hits

Sequence:  NP_724753.1.81976
Domain Number - Region: 330-397
Classification Level Classification E-value
Superfamily RING/U-box 0.00656
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_724753.1.81976
Sequence length 565
Comment suppressor of variegation 2-10, isoform C [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPFPSLQECEQMVQMLRVVELQKILSFLNISFAGRKTDLQSRILSFLRTNLELLAPKVQE
VYAQSVQEQNATLQYIDPTRMYSHIQLPPTVQPNPVGLVGSGQGVQVPGGQMNVVGGAPF
LHTHSINSQLPIHPDVRLKKLAFYDVLGTLIKPSTLVPRNTQRVQEVPFYFTLTPQQATE
IASNRDIRNSSKVEHAIQVQLRFCLVETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRP
NVEPKRPPRPVNVTSNVKLSPTVTNTITVQWCPDYTRSYCLAVYLVKKLTSTQLLQRMKT
KGVKPADYTRGLIKEKLTEDADCEIATTMLKVSLNCPLGKMKMLLPCRASTCSHLQCFDA
SLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTP
GLRSETQILDTPSKPAQKVEVISDDIELISDDAKPVKRDLSPAQDEQPTSTSNSETVDLT
LSDSDDDMPLAKRRPPAKQAVASSTSNGSGGGQRAYTPAQQPQQSGGNVFKKPQKAEELY
KRVHLGVWLRPRKPKPESSRRPNVG
Download sequence
Identical sequences A1Z7P9
FBpp0087654 NP_724753.1.81976 FBpp0087654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]