SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_725062.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_725062.2.81976
Domain Number 1 Region: 145-247
Classification Level Classification E-value
Superfamily Bromodomain 2.75e-36
Family Bromodomain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_725062.2.81976
Sequence length 249
Comment toutatis, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MPGVYPVYTPVAAGNFSAGLINQAPVQPAMPFANVVAMSPRAVTPTRTRTPTPTPAPTPP
PPPPTPLLMQASPTATALHVNACQSPPQQQHAQLMTMPSPPAIGVGTATNQMSPPPINIH
AIQEAKEKLKQEKKEKHATKKLMKELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYRKI
IKTPMDLSTIKKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFESR
WGELTDKHS
Download sequence
Identical sequences Q95T46
FBpp0087196 FBpp0087196 NP_725062.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]