SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_725278.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_725278.1.81976
Domain Number 1 Region: 64-150
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.22e-22
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 115-426
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000915
Family Rhodopsin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_725278.1.81976
Sequence length 443
Comment diuretic hormone 31 receptor, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSDQIGNPNATFSGSGSGSGTNVASIAESVAESGPDFDALRAACETRLNASGQLAGSGGP
GAEAGTHCAGTFDGWLCWPDTAVGTSAYELCPDFITGFDPARYAHKECGLDGEWFKHPLT
NKTWSNYTTCVNLEDLNWRHTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHMN
LFASFAANNSLWLVWYLLVMPNSELLHQSPMRCVALHITLHYFLLSNYSWMLCEGFYLHT
VLVAAFISEKRLVKWLIAFGWGSPAIVIFVYSMARGLGGTPEDNRHCWMNQTNYQNILMV
PVCISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRTVLQAFRATLLLVPLLGLQYIL
TPFRPAPKHPWENTYEIISAFTASFQGLCVAILFCFCNGEVIAQMKRKWRMMCFSNRPRT
NSYTATQVSFVRCGPPLPGEEKV
Download sequence
Identical sequences A1Z9B7
7227.FBpp0086868 NP_725278.1.81976 FBpp0086868 FBpp0086868 FBpp0086868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]