SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_725851.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_725851.1.81976
Domain Number 1 Region: 352-645
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.41e-85
Family beta-glycanases 0.0000000908
Further Details:      
 
Domain Number 2 Region: 47-236
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.46e-55
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00000545
Further Details:      
 
Domain Number 3 Region: 238-349
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 2.33e-19
Family beta-Galactosidase/glucuronidase domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_725851.1.81976
Sequence length 670
Comment uncharacterized protein Dmel_CG15117, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MHLRIRLTCRKYEIWALSIFSLVTGLYVLHFSIALILVNKEVPQTRGMLYPRESETREVR
SLDGIWNFVRSDQANPTQGVRDEWYAKELSKSRPTIPMPVPASYNDITTDNLRDHVGTVW
YDRKFFVPRSWSKDQRIWLRFGSVHYEAYVWINGQKVVKHEMGHLPFEAEVTDLLSYGAE
NRITVMCDNALIQTTVPQGRITEVPNDGGMTIVQSYTFDFFNYAGIHRSVHLYTTPRTFI
EEVEVTTNLSKDATVGEVFYSVSVNGSAANEADNVLQIQANLYDKDGILVANATSDQKLG
GKLQVNPVKPWWPYLMHSEPGYLYQLEIKLLATNDELLDVYRLKVGIRTLSWNSQQFLIN
GKPVYFRGFGRHEDSDIRGKGLDNALMVRDFNLLKWIGANAYRTSHYPYSEESMQFADEH
GIMIIDECPSVDTENFSQELLGKHKSSLEQLIHRDRNHPSVVMWSIANEPRTGSVSADSY
FELVANFTRSLDKTRPITAAIAVSNTQDKAGRSLDIISFNRYNAWYSNAGRLDMITQNVI
DEAIAWNKRYNKPIIMSEYGADTLEGLHMQPAYVWSEEFQTEVFSRHFKAFDELRKKGWF
IGEFVWNFADFKTAQSYTRVGGNKKGVFTRARQPKAAAHLLRKRYFALGRDLDQCSFPED
LFTYIADLIS
Download sequence
Identical sequences A1ZBG9
7227.FBpp0085778 FBpp0085777 FBpp0085778 FBpp0085778 NP_725851.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]